SCOPe 2.08: Domain d3c5ca_: 3c5c A:

Lineage for d3c5ca_ (3c5c A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d3c5ca_: 3c5c A: [208789]
   Other proteins in same PDB: d3c5cc2
   automated match to d3gftc_
   complexed with gdp, mg, unx

Details for d3c5ca_

PDB Entry: 3c5c, 1.85 Å

PDB Description: crystal structure of human ras-like, family 12 protein in complex with gdp

PDB Compounds: (A:) RAS-like protein 12

SCOPe Domain Sequences for d3c5ca_:

Sequence, based on SEQRES records:

>d3c5ca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm
aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

Sequence, based on observed residues (ATOM records):

>d3c5ca_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadp
rncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldmaqy
rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

Timeline for d3c5ca_:

• d3c5ca_ first appeared in SCOPe 2.03
  
• d3c5ca_ appears in SCOPe 2.07