Lineage for d3c4va_ (3c4v A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142548Species Corynebacterium glutamicum [TaxId:1718] [195114] (3 PDB entries)
  8. 2142551Domain d3c4va_: 3c4v A: [208786]
    automated match to d3c48b_
    complexed with lip, mg, udp

Details for d3c4va_

PDB Entry: 3c4v (more details), 2.6 Å

PDB Description: Structure of the retaining glycosyltransferase MshA:The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum : Complex with UDP and 1L-INS-1-P.
PDB Compounds: (A:) Predicted glycosyltransferases

SCOPe Domain Sequences for d3c4va_:

Sequence, based on SEQRES records: (download)

>d3c4va_ c.87.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mrvamismhtsplqqpgtgdsggmnvyilstatelakqgievdiytratrpsqgeivrva
enlrviniaagpyeglskeelptqlaaftggmlsftrrekvtydlihshywlsgqvgwll
rdlwriplihtahtlaavknsyrddsdtpesearriceqqlvdnadvlavntqeemqdlm
hhydadpdrisvvspgadvelyspgndratersrrelgiplhtkvvafvgrlqpfkgpqv
likavaalfdrdpdrnlrviicggpsgpnatpdtyrhmaeelgvekrirfldprppselv
avyraadivavpsfnesfglvameaqasgtpviaarvgglpiavaegetgllvdghspha
wadalatlldddetrirmgedavehartfswaataaqlsslyndaiane

Sequence, based on observed residues (ATOM records): (download)

>d3c4va_ c.87.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mrvamismhtsplqqpgtgdsggmnvyilstatelakqgievdiytratrpsqgeivrva
enlrviniaagpyeglskeelptqlaaftggmlsftrrekvtydlihshywlsgqvgwll
rdlwriplihtahtlaavdtpesearriceqqlvdnadvlavntqeemqdlmhhydadpd
risvvspgadvelyspgndratersrrelgiplhtkvvafvgrlqpfkgpqvlikavaal
fdrdpdrnlrviicggptyrhmaeelgvekrirfldprppselvavyraadivavpsfne
sfglvameaqasgtpviaarvgglpiavaegetgllvdghsphawadalatlldddetri
rmgedavehartfswaataaqlsslyndaiane

SCOPe Domain Coordinates for d3c4va_:

Click to download the PDB-style file with coordinates for d3c4va_.
(The format of our PDB-style files is described here.)

Timeline for d3c4va_: