Lineage for d3c4ha2 (3c4h A:322-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234206Domain d3c4ha2: 3c4h A:322-532 [208781]
    Other proteins in same PDB: d3c4ha1, d3c4ha3
    automated match to d1gs0a2
    complexed with dms, drl

Details for d3c4ha2

PDB Entry: 3c4h (more details), 2.1 Å

PDB Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor DR2313
PDB Compounds: (A:) Poly(ADP-ribose) polymerase 3

SCOPe Domain Sequences for d3c4ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c4ha2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

SCOPe Domain Coordinates for d3c4ha2:

Click to download the PDB-style file with coordinates for d3c4ha2.
(The format of our PDB-style files is described here.)

Timeline for d3c4ha2: