Lineage for d3c2ud1 (3c2u D:1-326)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553770Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1553776Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1553898Family b.67.2.0: automated matches [227228] (1 protein)
    not a true family
  6. 1553899Protein automated matches [226971] (1 species)
    not a true protein
  7. 1553900Species Selenomonas ruminantium [TaxId:971] [225444] (1 PDB entry)
  8. 1553904Domain d3c2ud1: 3c2u D:1-326 [208774]
    Other proteins in same PDB: d3c2ua2, d3c2ub2, d3c2uc2, d3c2ud2
    automated match to d2exja2
    complexed with b3p

Details for d3c2ud1

PDB Entry: 3c2u (more details), 1.3 Å

PDB Description: structure of the two subsite d-xylosidase from selenomonas ruminantium in complex with 1,3-bis[tris(hydroxymethyl)methylamino]propane
PDB Compounds: (D:) Xylosidase/arabinosidase

SCOPe Domain Sequences for d3c2ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2ud1 b.67.2.0 (D:1-326) automated matches {Selenomonas ruminantium [TaxId: 971]}
mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
dgwpvvvggqqgsleveapdlpqqew

SCOPe Domain Coordinates for d3c2ud1:

Click to download the PDB-style file with coordinates for d3c2ud1.
(The format of our PDB-style files is described here.)

Timeline for d3c2ud1: