SCOPe 2.05: Domain d3c2uc2: 3c2u C:327-537

Lineage for d3c2uc2 (3c2u C:327-537)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Selenomonas ruminantium [TaxId:971] [225445] (1 PDB entry)

8. Domain d3c2uc2: 3c2u C:327-537 [208773]
   Other proteins in same PDB: d3c2ua1, d3c2ub1, d3c2uc1, d3c2ud1
   automated match to d2exha1
   complexed with b3p

Details for d3c2uc2

PDB Entry: 3c2u, 1.3 Å

PDB Description: structure of the two subsite d-xylosidase from selenomonas ruminantium in complex with 1,3-bis[tris(hydroxymethyl)methylamino]propane

PDB Compounds: (C:) Xylosidase/arabinosidase

SCOPe Domain Sequences for d3c2uc2:

Sequence; same for both SEQRES and ATOM records:

>d3c2uc2 b.29.1.0 (C:327-537) automated matches {Selenomonas ruminantium [TaxId: 971]}
aptyeerddfdkdtlninfqtlripfsehlgsltarpgflrlygreslqskftqahiarr
wqsfnfdagtsvefspnsfqqmagltcyyntenwssihvtwneekgriidlvtadngtfs
mplagaeipipdevktvhfkvsvrgriyqyaysfdgetfhtlpielpswklsddyvrggg
fftgafvginaiditgtalpadfdyftykel

Timeline for d3c2uc2:

• d3c2uc2 first appeared in SCOPe 2.03
  
• d3c2uc2 appears in SCOPe 2.04
  
• d3c2uc2 appears in SCOPe 2.06
  
• d3c2uc2 appears in the current release, SCOPe 2.08