Lineage for d3c2uc2 (3c2u C:327-537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781314Species Selenomonas ruminantium [TaxId:971] [225445] (1 PDB entry)
  8. 2781317Domain d3c2uc2: 3c2u C:327-537 [208773]
    Other proteins in same PDB: d3c2ua1, d3c2ub1, d3c2uc1, d3c2ud1
    automated match to d2exha1
    complexed with b3p

Details for d3c2uc2

PDB Entry: 3c2u (more details), 1.3 Å

PDB Description: structure of the two subsite d-xylosidase from selenomonas ruminantium in complex with 1,3-bis[tris(hydroxymethyl)methylamino]propane
PDB Compounds: (C:) Xylosidase/arabinosidase

SCOPe Domain Sequences for d3c2uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2uc2 b.29.1.0 (C:327-537) automated matches {Selenomonas ruminantium [TaxId: 971]}
aptyeerddfdkdtlninfqtlripfsehlgsltarpgflrlygreslqskftqahiarr
wqsfnfdagtsvefspnsfqqmagltcyyntenwssihvtwneekgriidlvtadngtfs
mplagaeipipdevktvhfkvsvrgriyqyaysfdgetfhtlpielpswklsddyvrggg
fftgafvginaiditgtalpadfdyftykel

SCOPe Domain Coordinates for d3c2uc2:

Click to download the PDB-style file with coordinates for d3c2uc2.
(The format of our PDB-style files is described here.)

Timeline for d3c2uc2: