![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Selenomonas ruminantium [TaxId:971] [225445] (1 PDB entry) |
![]() | Domain d3c2uc2: 3c2u C:327-537 [208773] Other proteins in same PDB: d3c2ua1, d3c2ub1, d3c2uc1, d3c2ud1 automated match to d2exha1 complexed with b3p |
PDB Entry: 3c2u (more details), 1.3 Å
SCOPe Domain Sequences for d3c2uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2uc2 b.29.1.0 (C:327-537) automated matches {Selenomonas ruminantium [TaxId: 971]} aptyeerddfdkdtlninfqtlripfsehlgsltarpgflrlygreslqskftqahiarr wqsfnfdagtsvefspnsfqqmagltcyyntenwssihvtwneekgriidlvtadngtfs mplagaeipipdevktvhfkvsvrgriyqyaysfdgetfhtlpielpswklsddyvrggg fftgafvginaiditgtalpadfdyftykel
Timeline for d3c2uc2: