Lineage for d1igyb4 (1igy B:363-474)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289555Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 289590Species Mouse (Mus musculus) [TaxId:10090] [88591] (2 PDB entries)
  8. 289593Domain d1igyb4: 1igy B:363-474 [20877]
    Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb2, d1igyb3, d1igyc1, d1igyc2, d1igyd1, d1igyd2, d1igyd3

Details for d1igyb4

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus)}
kprapqvytipppkeqmakdkvsltcmitdffpeditvewqsdgqapenykntqpimdtd
gsyfvysklnvqksnweagntftcsvlheglhnhhtekslsh

SCOP Domain Coordinates for d1igyb4:

Click to download the PDB-style file with coordinates for d1igyb4.
(The format of our PDB-style files is described here.)

Timeline for d1igyb4: