SCOP 1.59: Domain d1igyb4: 1igy B:363-474

Lineage for d1igyb4 (1igy B:363-474)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48974] (1 PDB entry)

8. Domain d1igyb4: 1igy B:363-474 [20877]
   Other proteins in same PDB: d1igya1, d1igyb1, d1igyc1, d1igyd1

Details for d1igyb4

PDB Entry: 1igy, 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyb4:

Sequence; same for both SEQRES and ATOM records:

>d1igyb4 b.1.1.2 (B:363-474) Immunoglobulin (constant domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
kprapqvytipppkeqmakdkvsltcmitdffpeditvewqsdgqapenykntqpimdtd
gsyfvysklnvqksnweagntftcsvlheglhnhhtekslsh

Timeline for d1igyb4:

• d1igyb4 first appeared (with stable ids) in SCOP 1.55
  
• d1igyb4 appears in SCOP 1.57
  
• d1igyb4 appears in SCOP 1.61
  
• d1igyb4 appears in the current release, SCOPe 2.08