Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (37 species) not a true protein |
Species Selenomonas ruminantium [TaxId:971] [225445] (1 PDB entry) |
Domain d3c2ua2: 3c2u A:327-538 [208769] Other proteins in same PDB: d3c2ua1, d3c2ub1, d3c2uc1, d3c2ud1 automated match to d2exha1 complexed with b3p |
PDB Entry: 3c2u (more details), 1.3 Å
SCOPe Domain Sequences for d3c2ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2ua2 b.29.1.0 (A:327-538) automated matches {Selenomonas ruminantium [TaxId: 971]} aptyeerddfdkdtlninfqtlripfsehlgsltarpgflrlygreslqskftqahiarr wqsfnfdagtsvefspnsfqqmagltcyyntenwssihvtwneekgriidlvtadngtfs mplagaeipipdevktvhfkvsvrgriyqyaysfdgetfhtlpielpswklsddyvrggg fftgafvginaiditgtalpadfdyftykeld
Timeline for d3c2ua2: