SCOPe 2.08: Domain d3c2ua1: 3c2u A:1-326

Lineage for d3c2ua1 (3c2u A:1-326)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (4 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.0: automated matches [227228] (1 protein)
   not a true family

6. Protein automated matches [226971] (7 species)
   not a true protein

7. Species Selenomonas ruminantium [TaxId:971] [225444] (1 PDB entry)

8. Domain d3c2ua1: 3c2u A:1-326 [208768]
   Other proteins in same PDB: d3c2ua2, d3c2ub2, d3c2uc2, d3c2ud2
   automated match to d2exja2
   complexed with b3p

Details for d3c2ua1

PDB Entry: 3c2u, 1.3 Å

PDB Description: structure of the two subsite d-xylosidase from selenomonas ruminantium in complex with 1,3-bis[tris(hydroxymethyl)methylamino]propane

PDB Compounds: (A:) Xylosidase/arabinosidase

SCOPe Domain Sequences for d3c2ua1:

Sequence; same for both SEQRES and ATOM records:

>d3c2ua1 b.67.2.0 (A:1-326) automated matches {Selenomonas ruminantium [TaxId: 971]}
mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef
ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil
lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt
diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh
nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq
dgwpvvvggqqgsleveapdlpqqew

Timeline for d3c2ua1:

• d3c2ua1 first appeared in SCOPe 2.03
  
• d3c2ua1 appears in SCOPe 2.07