Lineage for d3c0ea1 (3c0e A:1-214)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2579778Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2579779Protein HSP90 [55876] (3 species)
  7. 2579780Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55877] (32 PDB entries)
  8. 2579785Domain d3c0ea1: 3c0e A:1-214 [208760]
    Other proteins in same PDB: d3c0ea2
    automated match to d1ah8a_
    mutant

Details for d3c0ea1

PDB Entry: 3c0e (more details), 1.9 Å

PDB Description: yeast hsp82 n-terminal domain: effects of mutants 98-99 ks-aa
PDB Compounds: (A:) ATP-dependent molecular chaperone hsp82

SCOPe Domain Sequences for d3c0ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c0ea1 d.122.1.1 (A:1-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
masetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletep
dlfiritpkpeqkvleirdsgigmtkaelinnlgtiaaagtkafmealsagadvsmigqf
gvgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkdd
qleyleekrikevikrhsefvaypiqlvvtkeve

SCOPe Domain Coordinates for d3c0ea1:

Click to download the PDB-style file with coordinates for d3c0ea1.
(The format of our PDB-style files is described here.)

Timeline for d3c0ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c0ea2