![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
![]() | Domain d3bz4g1: 3bz4 G:1-107 [208757] Other proteins in same PDB: d3bz4a2, d3bz4c2, d3bz4e2, d3bz4g2 automated match to d1dqdl1 complexed with pd |
PDB Entry: 3bz4 (more details), 1.8 Å
SCOPe Domain Sequences for d3bz4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz4g1 b.1.1.0 (G:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleik
Timeline for d3bz4g1: