Lineage for d3bz4e2 (3bz4 E:108-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2353853Domain d3bz4e2: 3bz4 E:108-211 [208756]
    Other proteins in same PDB: d3bz4a1, d3bz4c1, d3bz4e1, d3bz4g1
    automated match to d1dqdl2
    complexed with pd

Details for d3bz4e2

PDB Entry: 3bz4 (more details), 1.8 Å

PDB Description: Crystal structure of Fab F22-4 in complex with a Shigella flexneri 2a O-Ag decasaccharide
PDB Compounds: (E:) Fab F22-4 light chain

SCOPe Domain Sequences for d3bz4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz4e2 b.1.1.2 (E:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3bz4e2:

Click to download the PDB-style file with coordinates for d3bz4e2.
(The format of our PDB-style files is described here.)

Timeline for d3bz4e2: