| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3bz4e1: 3bz4 E:1-107 [208755] Other proteins in same PDB: d3bz4a2, d3bz4b_, d3bz4c2, d3bz4d_, d3bz4e2, d3bz4f_, d3bz4g2, d3bz4h_ automated match to d1dqdl1 complexed with pd |
PDB Entry: 3bz4 (more details), 1.8 Å
SCOPe Domain Sequences for d3bz4e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz4e1 b.1.1.0 (E:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleik
Timeline for d3bz4e1: