![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
![]() | Domain d3bz4c2: 3bz4 C:108-213 [208754] Other proteins in same PDB: d3bz4a1, d3bz4c1, d3bz4e1, d3bz4g1 automated match to d1dqdl2 complexed with pd |
PDB Entry: 3bz4 (more details), 1.8 Å
SCOPe Domain Sequences for d3bz4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz4c2 b.1.1.2 (C:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d3bz4c2: