SCOPe 2.08: Domain d3bz4c2: 3bz4 C:108-213

Lineage for d3bz4c2 (3bz4 C:108-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3bz4c2: 3bz4 C:108-213 [208754]
Other proteins in same PDB: d3bz4a1, d3bz4b_, d3bz4c1, d3bz4d_, d3bz4e1, d3bz4f_, d3bz4g1, d3bz4h_
automated match to d1dqdl2
complexed with pd

Details for d3bz4c2

PDB Entry: 3bz4 (more details), 1.8 Å

PDB Description: crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag decasaccharide

PDB Compounds: (C:) Fab F22-4 light chain

SCOPe Domain Sequences for d3bz4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz4c2 b.1.1.2 (C:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3bz4c2:

Click to download the PDB-style file with coordinates for d3bz4c2.
(The format of our PDB-style files is described here.)

Timeline for d3bz4c2: