SCOPe 2.04: Domain d3bz4c1: 3bz4 C:1-107

Lineage for d3bz4c1 (3bz4 C:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3bz4c1: 3bz4 C:1-107 [208753]
   Other proteins in same PDB: d3bz4a2, d3bz4c2, d3bz4e2, d3bz4g2
   automated match to d1dqdl1
   complexed with pd

Details for d3bz4c1

PDB Entry: 3bz4, 1.8 Å

PDB Description: crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag decasaccharide

PDB Compounds: (C:) Fab F22-4 light chain

SCOPe Domain Sequences for d3bz4c1:

Sequence; same for both SEQRES and ATOM records:

>d3bz4c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaafsnpvtlgtsasiscrssksllhsdgitylywylqkpgqsphlliyhlsnla
sgvpdrfsssgsgtdftlrisrveaedvgiyycahnvelprtfgggtkleik

Timeline for d3bz4c1:

• d3bz4c1 first appeared in SCOPe 2.03
  
• d3bz4c1 appears in SCOPe 2.05
  
• d3bz4c1 appears in the current release, SCOPe 2.08