SCOPe 2.06: Domain d3byic_: 3byi C:

Lineage for d3byic_ (3byi C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
   multihelical

4. Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families)

5. Family a.116.1.0: automated matches [227202] (1 protein)
   not a true family

6. Protein automated matches [226932] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225230] (9 PDB entries)

8. Domain d3byic_: 3byi C: [208747]
   Other proteins in same PDB: d3byia2, d3byib2
   automated match to d1grnb_

Details for d3byic_

PDB Entry: 3byi, 2.25 Å

PDB Description: Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15)

PDB Compounds: (C:) Rho GTPase activating protein 15

SCOPe Domain Sequences for d3byic_:

Sequence; same for both SEQRES and ATOM records:

>d3byic_ a.116.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pslktlqekglikdqifgshlhkvcerenstvpwfvkqcieavekrgldvdgiyrvsgnl
atiqklrfivnqeeklnlddsqwedihvvtgalkmffrelpeplfpysffeqfveaikkq
dnntrieavkslvqklpppnrdtmkvlfghltkivakasknlmstqslgivfgptllrae
netgnmaihmvyqnqiaelmlseyskifgs

Timeline for d3byic_:

• d3byic_ first appeared in SCOPe 2.03
  
• d3byic_ appears in SCOPe 2.05
  
• d3byic_ appears in SCOPe 2.07
  
• d3byic_ appears in the current release, SCOPe 2.08