Class a: All alpha proteins [46456] (290 folds) |
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) |
Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
Protein automated matches [226932] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries) |
Domain d3byic_: 3byi C: [208747] Other proteins in same PDB: d3byia2, d3byib2 automated match to d1grnb_ |
PDB Entry: 3byi (more details), 2.25 Å
SCOPe Domain Sequences for d3byic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3byic_ a.116.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pslktlqekglikdqifgshlhkvcerenstvpwfvkqcieavekrgldvdgiyrvsgnl atiqklrfivnqeeklnlddsqwedihvvtgalkmffrelpeplfpysffeqfveaikkq dnntrieavkslvqklpppnrdtmkvlfghltkivakasknlmstqslgivfgptllrae netgnmaihmvyqnqiaelmlseyskifgs
Timeline for d3byic_: