Lineage for d3byic_ (3byi C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725299Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2725300Protein automated matches [226932] (4 species)
    not a true protein
  7. 2725303Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries)
  8. 2725312Domain d3byic_: 3byi C: [208747]
    Other proteins in same PDB: d3byia2, d3byib2
    automated match to d1grnb_

Details for d3byic_

PDB Entry: 3byi (more details), 2.25 Å

PDB Description: Crystal structure of human Rho GTPase activating protein 15 (ARHGAP15)
PDB Compounds: (C:) Rho GTPase activating protein 15

SCOPe Domain Sequences for d3byic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3byic_ a.116.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pslktlqekglikdqifgshlhkvcerenstvpwfvkqcieavekrgldvdgiyrvsgnl
atiqklrfivnqeeklnlddsqwedihvvtgalkmffrelpeplfpysffeqfveaikkq
dnntrieavkslvqklpppnrdtmkvlfghltkivakasknlmstqslgivfgptllrae
netgnmaihmvyqnqiaelmlseyskifgs

SCOPe Domain Coordinates for d3byic_:

Click to download the PDB-style file with coordinates for d3byic_.
(The format of our PDB-style files is described here.)

Timeline for d3byic_: