Lineage for d3bwre_ (3bwr E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076457Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2076790Family b.121.6.0: automated matches [227135] (1 protein)
    not a true family
  6. 2076791Protein automated matches [226836] (6 species)
    not a true protein
  7. 2076846Species Simian virus 40 [TaxId:10633] [225418] (2 PDB entries)
  8. 2076851Domain d3bwre_: 3bwr E: [208741]
    automated match to d1vpsa_
    complexed with edo

Details for d3bwre_

PDB Entry: 3bwr (more details), 2.25 Å

PDB Description: sv40 vp1 pentamer in complex with gm1 oligosaccharide
PDB Compounds: (E:) Capsid protein VP1

SCOPe Domain Sequences for d3bwre_:

Sequence, based on SEQRES records: (download)

>d3bwre_ b.121.6.0 (E:) automated matches {Simian virus 40 [TaxId: 10633]}
ievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysva
riplpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhf
favggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpd
psknentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglft
ntsgtqqwkglpryfkitlrkrsvkn

Sequence, based on observed residues (ATOM records): (download)

>d3bwre_ b.121.6.0 (E:) automated matches {Simian virus 40 [TaxId: 10633]}
ievlgvktdsftevecflnpqmgnpdehqkglskslaaekqftddspdkeqlpcysvari
plpninedltcgnilmweavtvktevigvtamlnlhsgtqkthengagkpiqgsnfhffa
vggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhkavldkdnaypvecwvpdps
knentryfgtytggenvppvlhitntattvlldeqgvgplckadslyvsavdicglftnt
sgtqqwkglpryfkitlrkrsvkn

SCOPe Domain Coordinates for d3bwre_:

Click to download the PDB-style file with coordinates for d3bwre_.
(The format of our PDB-style files is described here.)

Timeline for d3bwre_: