Lineage for d1igtd4 (1igt D:363-474)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360011Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2360156Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry)
  8. 2360158Domain d1igtd4: 1igt D:363-474 [20873]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3
    part of intact IgG2a antibody Mab231

Details for d1igtd4

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (D:) igg2a intact antibody - mab231

SCOPe Domain Sequences for d1igtd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd4 b.1.1.2 (D:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOPe Domain Coordinates for d1igtd4:

Click to download the PDB-style file with coordinates for d1igtd4.
(The format of our PDB-style files is described here.)

Timeline for d1igtd4: