| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
| Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry) |
| Domain d1igtd4: 1igt D:363-474 [20873] Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3 part of intact IgG2a antibody Mab231 |
PDB Entry: 1igt (more details), 2.8 Å
SCOPe Domain Sequences for d1igtd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtd4 b.1.1.2 (D:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr
Timeline for d1igtd4: