Lineage for d1igtd4 (1igt D:363-474)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289555Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 289595Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry)
  8. 289597Domain d1igtd4: 1igt D:363-474 [20873]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3
    part of intact IgG2a antibody Mab231
    complexed with fuc, gal, man, nag

Details for d1igtd4

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd4 b.1.1.2 (D:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOP Domain Coordinates for d1igtd4:

Click to download the PDB-style file with coordinates for d1igtd4.
(The format of our PDB-style files is described here.)

Timeline for d1igtd4: