Lineage for d1igtd4 (1igt D:363-474)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9216Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48973] (1 PDB entry)
  8. 9224Domain d1igtd4: 1igt D:363-474 [20873]
    Other proteins in same PDB: d1igta1, d1igtb1, d1igtc1, d1igtd1

Details for d1igtd4

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd4 b.1.1.2 (D:363-474) Immunoglobulin (constant domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOP Domain Coordinates for d1igtd4:

Click to download the PDB-style file with coordinates for d1igtd4.
(The format of our PDB-style files is described here.)

Timeline for d1igtd4: