SCOPe 2.03: Domain d3bvza2: 3bvz A:121-239

Lineage for d3bvza2 (3bvz A:121-239)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (18 PDB entries)
   Uniprot P23313

8. Domain d3bvza2: 3bvz A:121-239 [208729]
   Other proteins in same PDB: d3bvza1
   automated match to d1i4pa2
   complexed with zn

Details for d3bvza2

PDB Entry: 3bvz, 2.3 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (A:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bvza2:

Sequence; same for both SEQRES and ATOM records:

>d3bvza2 d.15.6.1 (A:121-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d3bvza2:

• d3bvza2 is new in SCOPe 2.03-stable
  
• d3bvza2 appears in SCOPe 2.04
  
• d3bvza2 appears in the current release, SCOPe 2.08