Lineage for d3bvza1 (3bvz A:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398637Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)
  7. 2398638Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
    Uniprot P23313
  8. 2398643Domain d3bvza1: 3bvz A:1-120 [208728]
    Other proteins in same PDB: d3bvza2
    automated match to d1i4pa1
    complexed with zn

Details for d3bvza1

PDB Entry: 3bvz (more details), 2.3 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
PDB Compounds: (A:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bvza1:

Sequence, based on SEQRES records: (download)

>d3bvza1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkwwhgktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d3bvza1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfgktcmyggitkheg

SCOPe Domain Coordinates for d3bvza1:

Click to download the PDB-style file with coordinates for d3bvza1.
(The format of our PDB-style files is described here.)

Timeline for d3bvza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bvza2