SCOPe 2.03: Domain d3bvpa_: 3bvp A:

Lineage for d3bvpa_ (3bvp A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)
   automatically mapped to Pfam PF00239

5. Family c.53.1.0: automated matches [227230] (1 protein)
   not a true family

6. Protein automated matches [226976] (2 species)
   not a true protein

7. Species Lactococcus phage [TaxId:35345] [225498] (1 PDB entry)

8. Domain d3bvpa_: 3bvp A: [208726]
   automated match to d2rslb_

Details for d3bvpa_

PDB Entry: 3bvp, 2.1 Å

PDB Description: crystal structure of the n-terminal catalytic domain of tp901-1 integrase

PDB Compounds: (A:) TP901-1 Integrase

SCOPe Domain Sequences for d3bvpa_:

Sequence; same for both SEQRES and ATOM records:

>d3bvpa_ c.53.1.0 (A:) automated matches {Lactococcus phage [TaxId: 35345]}
kkvaiytrvsttnqaeegfsideqidrltkyaeamgwqvsdtytdagfsgaklerpamqr
lindienkafdtvlvykldrlsrsvrdtlylvkdvftknkidfislnesidtssamgslf
ltilsainefereley

Timeline for d3bvpa_:

• d3bvpa_ is new in SCOPe 2.03-stable
  
• d3bvpa_ appears in SCOPe 2.04
  
• d3bvpa_ appears in the current release, SCOPe 2.08, called d3bvpa1