SCOPe 2.08: Domain d3bvma2: 3bvm A:121-237

Lineage for d3bvma2 (3bvm A:121-237)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d3bvma2: 3bvm A:121-237 [208725]
   Other proteins in same PDB: d3bvma1
   automated match to d1i4pa2
   complexed with zn

Details for d3bvma2

PDB Entry: 3bvm, 2 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (A:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bvma2:

Sequence; same for both SEQRES and ATOM records:

>d3bvma2 d.15.6.1 (A:121-237) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d3bvma2:

• d3bvma2 first appeared in SCOPe 2.03
  
• d3bvma2 appears in SCOPe 2.07