Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein automated matches [226992] (1 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225594] (7 PDB entries) |
Domain d3bvma1: 3bvm A:1-120 [208724] Other proteins in same PDB: d3bvma2 automated match to d1i4pa1 complexed with zn |
PDB Entry: 3bvm (more details), 2 Å
SCOPe Domain Sequences for d3bvma1:
Sequence, based on SEQRES records: (download)
>d3bvma1 b.40.2.2 (A:1-120) automated matches {Staphylococcus aureus [TaxId: 1280]} esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnkwwpgktcmyggitkheg
>d3bvma1 b.40.2.2 (A:1-120) automated matches {Staphylococcus aureus [TaxId: 1280]} esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn ydkvktellnedlakkykdevvdvygsnyyvncyfgktcmyggitkheg
Timeline for d3bvma1: