SCOPe 2.07: Domain d3bvga1: 3bvg A:1-120

Lineage for d3bvga1 (3bvg A:1-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50229] (20 PDB entries)
   Uniprot P23313

8. Domain d3bvga1: 3bvg A:1-120 [208722]
   Other proteins in same PDB: d3bvga2
   automated match to d1i4pa1
   complexed with zn

Details for d3bvga1

PDB Entry: 3bvg, 2 Å

PDB Description: Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex

PDB Compounds: (A:) Enterotoxin type C-3

SCOPe Domain Sequences for d3bvga1:

Sequence, based on SEQRES records:

>d3bvga1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdastwhgktcmyggitkheg

Sequence, based on observed residues (ATOM records):

>d3bvga1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfgktcmyggitkheg

Timeline for d3bvga1:

• d3bvga1 first appeared in SCOPe 2.03
  
• d3bvga1 appears in SCOPe 2.06
  
• d3bvga1 appears in the current release, SCOPe 2.08