| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88587] (1 PDB entry) |
| Domain d1igtd3: 1igt D:236-361 [20872] Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd4 part of intact IgG2a antibody Mab231 complexed with fuc, gal, man, nag |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igtd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtd3 b.1.1.2 (D:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2}
pcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnv
evhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkg
Timeline for d1igtd3: