![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.1: Armadillo repeat [48372] (7 proteins) this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain |
![]() | Protein automated matches [190070] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186790] (4 PDB entries) |
![]() | Domain d3btrc_: 3btr C: [208718] automated match to d1q1sc_ protein/DNA complex |
PDB Entry: 3btr (more details), 2.6 Å
SCOPe Domain Sequences for d3btrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3btrc_ a.118.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nqgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflg ktdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni agdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldav eqilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpi vtpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdq iqqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnll sakdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasl nliekyf
Timeline for d3btrc_: