SCOPe 2.08: Domain d3brqb_: 3brq B:

Lineage for d3brqb_ (3brq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225166] (3 PDB entries)

8. Domain d3brqb_: 3brq B: [208717]
   automated match to d1jyfa_
   complexed with fru, na, so4

Details for d3brqb_

PDB Entry: 3brq, 2 Å

PDB Description: crystal structure of the escherichia coli transcriptional repressor ascg

PDB Compounds: (B:) HTH-type transcriptional regulator ascG

SCOPe Domain Sequences for d3brqb_:

Sequence; same for both SEQRES and ATOM records:

>d3brqb_ c.93.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqtlglvvtntlyhgiyfsellfhaarmaeekgrqllladgkhsaeeerqaiqylldlrc
daimiyprflsvdeiddiidahsqpimvlnrrlrknsshsvwcdhkqtsfnavaelinag
hqeiafltgsmdsptsierlagykdalaqhgialnekliangkwtpasgaegvemllerg
akfsalvasnddmaigamkalhergvavpeqvsvigfddiaiapytvpalssvkipvtem
iqeiigrlifmldggdfsppktfsgklirrdsliaps

Timeline for d3brqb_:

• d3brqb_ first appeared in SCOPe 2.03
  
• d3brqb_ appears in SCOPe 2.07