Lineage for d3br5a2 (3br5 A:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008196Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2008197Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2008260Domain d3br5a2: 3br5 A:73-187 [208709]
    Other proteins in same PDB: d3br5a1, d3br5b1, d3br5d1, d3br5e1
    automated match to d1jt6a2
    protein/DNA complex; complexed with rhq, so4; mutant

Details for d3br5a2

PDB Entry: 3br5 (more details), 2.9 Å

PDB Description: Crystal Structure of the Complex of Rhodamine 6G Bound to QacR(E90Q), a Mutant of a Multidrug Binding Transcriptional Repressor
PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br5a2:

Sequence, based on SEQRES records: (download)

>d3br5a2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelslttqyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Sequence, based on observed residues (ATOM records): (download)

>d3br5a2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelslttqyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d3br5a2:

Click to download the PDB-style file with coordinates for d3br5a2.
(The format of our PDB-style files is described here.)

Timeline for d3br5a2: