| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Multidrug binding protein QacR [68964] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries) Uniprot P23217 |
| Domain d3br5a1: 3br5 A:2-72 [208708] Other proteins in same PDB: d3br5a2, d3br5b2, d3br5d2, d3br5e2 automated match to d1jt6a1 protein/DNA complex; complexed with rhq, so4; mutant |
PDB Entry: 3br5 (more details), 2.9 Å
SCOPe Domain Sequences for d3br5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3br5a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkseqikc
Timeline for d3br5a1: