Lineage for d3br3a1 (3br3 A:3-72)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258262Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1258295Protein Multidrug binding protein QacR [68964] (1 species)
  7. 1258296Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 1258303Domain d3br3a1: 3br3 A:3-72 [208704]
    Other proteins in same PDB: d3br3a2, d3br3b2
    automated match to d1jt6a1
    protein/DNA complex; complexed with et, so4; mutant

Details for d3br3a1

PDB Entry: 3br3 (more details), 2.8 Å

PDB Description: crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3br3a1 a.4.1.9 (A:3-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
lkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskwq
eqwkseqika

SCOPe Domain Coordinates for d3br3a1:

Click to download the PDB-style file with coordinates for d3br3a1.
(The format of our PDB-style files is described here.)

Timeline for d3br3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3br3a2