Lineage for d3br0b2 (3br0 B:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011636Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2011637Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2011639Domain d3br0b2: 3br0 B:73-187 [208703]
    Other proteins in same PDB: d3br0a1, d3br0b1
    automated match to d1jt6a2
    protein/DNA complex; complexed with imd, mgr, so4; mutant

Details for d3br0b2

PDB Entry: 3br0 (more details), 2.42 Å

PDB Description: crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3br0b2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklqnkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d3br0b2:

Click to download the PDB-style file with coordinates for d3br0b2.
(The format of our PDB-style files is described here.)

Timeline for d3br0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3br0b1