SCOPe 2.08: Domain d3br0b2: 3br0 B:73-187

Lineage for d3br0b2 (3br0 B:73-187)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d3br0b2: 3br0 B:73-187 [208703]
   Other proteins in same PDB: d3br0a1, d3br0b1
   automated match to d1jt6a2
   protein/DNA complex; complexed with imd, mgr, so4; mutant

Details for d3br0b2

PDB Entry: 3br0, 2.42 Å

PDB Description: crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor

PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br0b2:

Sequence; same for both SEQRES and ATOM records:

>d3br0b2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklqnkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d3br0b2:

• d3br0b2 first appeared in SCOPe 2.03
  
• d3br0b2 appears in SCOPe 2.07