SCOPe 2.08: Domain d3br0a1: 3br0 A:2-72

Lineage for d3br0a1 (3br0 A:2-72)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d3br0a1: 3br0 A:2-72 [208700]
   Other proteins in same PDB: d3br0a2, d3br0b2
   automated match to d1jt6a1
   protein/DNA complex; complexed with imd, mgr, so4; mutant

Details for d3br0a1

PDB Entry: 3br0, 2.42 Å

PDB Description: crystal structure of the complex of malachite green bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor

PDB Compounds: (A:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d3br0a1:

Sequence; same for both SEQRES and ATOM records:

>d3br0a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkseqika

Timeline for d3br0a1:

• d3br0a1 first appeared in SCOPe 2.03
  
• d3br0a1 appears in SCOPe 2.07