Lineage for d1igtc2 (1igt C:109-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289893Domain d1igtc2: 1igt C:109-214 [20870]
    Other proteins in same PDB: d1igta1, d1igtb1, d1igtb2, d1igtb3, d1igtb4, d1igtc1, d1igtd1, d1igtd2, d1igtd3, d1igtd4
    part of intact IgG2a antibody Mab231
    complexed with fuc, gal, man, nag

Details for d1igtc2

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtc2 b.1.1.2 (C:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1igtc2:

Click to download the PDB-style file with coordinates for d1igtc2.
(The format of our PDB-style files is described here.)

Timeline for d1igtc2: