Class b: All beta proteins [48724] (177 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
Protein automated matches [190378] (6 species) not a true protein |
Species Human adenovirus 35 [TaxId:10522] [188348] (2 PDB entries) |
Domain d3bq4g_: 3bq4 G: [208698] automated match to d3f0yg_ |
PDB Entry: 3bq4 (more details), 2.7 Å
SCOPe Domain Sequences for d3bq4g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bq4g_ b.21.1.0 (G:) automated matches {Human adenovirus 35 [TaxId: 10522]} intlwtginpppncqiventntndgkltlvlvkngglvngyvslvgvsdtvnqmftqkta niqlrlyfdssgnllteesdlkiplknksstatsetvasskafmpsttaypfntttrdse nyihgicyymtsydrslfplnisimlnsrmissnvayaiqfewnlnasespesniatltt spfffsyitedd
Timeline for d3bq4g_: