SCOPe 2.04: Domain d3bq4f_: 3bq4 F:

Lineage for d3bq4f_ (3bq4 F:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.0: automated matches [191353] (1 protein)
   not a true family

6. Protein automated matches [190378] (5 species)
   not a true protein

7. Species Human adenovirus 35 [TaxId:10522] [188348] (2 PDB entries)

8. Domain d3bq4f_: 3bq4 F: [208697]
   automated match to d3f0yg_

Details for d3bq4f_

PDB Entry: 3bq4, 2.7 Å

PDB Description: crystal structure of ad35 fiber knob

PDB Compounds: (F:) Fiber

SCOPe Domain Sequences for d3bq4f_:

Sequence; same for both SEQRES and ATOM records:

>d3bq4f_ b.21.1.0 (F:) automated matches {Human adenovirus 35 [TaxId: 10522]}
intlwtginpppncqiventntndgkltlvlvkngglvngyvslvgvsdtvnqmftqkta
niqlrlyfdssgnllteesdlkiplknksstatsetvasskafmpsttaypfntttrdse
nyihgicyymtsydrslfplnisimlnsrmissnvayaiqfewnlnasespesniatltt
spfffsyitedd

Timeline for d3bq4f_:

• d3bq4f_ first appeared in SCOPe 2.03
  
• d3bq4f_ appears in SCOPe 2.05
  
• d3bq4f_ appears in the current release, SCOPe 2.08