Lineage for d3bq4d_ (3bq4 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778904Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 1778905Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 1779120Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 1779121Protein automated matches [190378] (6 species)
    not a true protein
  7. 1779142Species Human adenovirus 35 [TaxId:10522] [188348] (2 PDB entries)
  8. 1779146Domain d3bq4d_: 3bq4 D: [208695]
    automated match to d3f0yg_

Details for d3bq4d_

PDB Entry: 3bq4 (more details), 2.7 Å

PDB Description: crystal structure of ad35 fiber knob
PDB Compounds: (D:) Fiber

SCOPe Domain Sequences for d3bq4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bq4d_ b.21.1.0 (D:) automated matches {Human adenovirus 35 [TaxId: 10522]}
intlwtginpppncqiventntndgkltlvlvkngglvngyvslvgvsdtvnqmftqkta
niqlrlyfdssgnllteesdlkiplknksstatsetvasskafmpsttaypfntttrdse
nyihgicyymtsydrslfplnisimlnsrmissnvayaiqfewnlnasespesniatltt
spfffsyitedd

SCOPe Domain Coordinates for d3bq4d_:

Click to download the PDB-style file with coordinates for d3bq4d_.
(The format of our PDB-style files is described here.)

Timeline for d3bq4d_: