Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [225456] (2 PDB entries) |
Domain d3bpxa1: 3bpx A:1-145 [208691] Other proteins in same PDB: d3bpxa2 automated match to d2ethb_ complexed with na, sal |
PDB Entry: 3bpx (more details), 1.95 Å
SCOPe Domain Sequences for d3bpxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpxa1 a.4.5.0 (A:1-145) automated matches {Methanobacterium thermoautotrophicum [TaxId: 145262]} mdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvd kgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdft ederklfrkmcrrlaeeavrmrgew
Timeline for d3bpxa1: