SCOPe 2.08: Domain d3bpxa1: 3bpx A:1-145

Lineage for d3bpxa1 (3bpx A:1-145)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [225456] (2 PDB entries)

8. Domain d3bpxa1: 3bpx A:1-145 [208691]
   Other proteins in same PDB: d3bpxa2
   automated match to d2ethb_
   complexed with na, sal

Details for d3bpxa1

PDB Entry: 3bpx, 1.95 Å

PDB Description: Crystal Structure of MarR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3bpxa1:

Sequence; same for both SEQRES and ATOM records:

>d3bpxa1 a.4.5.0 (A:1-145) automated matches {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvd
kgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdft
ederklfrkmcrrlaeeavrmrgew

Timeline for d3bpxa1:

• d3bpxa1 first appeared in SCOPe 2.03, called d3bpxa_
  
• d3bpxa1 appears in SCOPe 2.07