SCOPe 2.03: Domain d3bpva_: 3bpv A:

Lineage for d3bpva_ (3bpv A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [225456] (2 PDB entries)

8. Domain d3bpva_: 3bpv A: [208690]
   automated match to d2ethb_

Details for d3bpva_

PDB Entry: 3bpv, 1.4 Å

PDB Description: Crystal Structure of MarR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3bpva_:

Sequence; same for both SEQRES and ATOM records:

>d3bpva_ a.4.5.0 (A:) automated matches {Methanobacterium thermoautotrophicum}
iplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvdkgti
artlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdfteder
klfrkmcrrlaeeavrm

Timeline for d3bpva_:

• d3bpva_ is new in SCOPe 2.03-stable
  
• d3bpva_ appears in SCOPe 2.04
  
• d3bpva_ appears in the current release, SCOPe 2.08