Lineage for d3bpva_ (3bpv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694905Species Methanobacterium thermoautotrophicum [TaxId:145262] [225456] (2 PDB entries)
  8. 2694906Domain d3bpva_: 3bpv A: [208690]
    automated match to d2ethb_

Details for d3bpva_

PDB Entry: 3bpv (more details), 1.4 Å

PDB Description: Crystal Structure of MarR
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3bpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpva_ a.4.5.0 (A:) automated matches {Methanobacterium thermoautotrophicum [TaxId: 145262]}
iplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffhvdkgti
artlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrdfteder
klfrkmcrrlaeeavrm

SCOPe Domain Coordinates for d3bpva_:

Click to download the PDB-style file with coordinates for d3bpva_.
(The format of our PDB-style files is described here.)

Timeline for d3bpva_: