SCOP 1.75: Domain d1igtb4: 1igt B:363-474

Lineage for d1igtb4 (1igt B:363-474)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry)

8. Domain d1igtb4: 1igt B:363-474 [20869]
   Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3
   part of intact IgG2a antibody Mab231

Details for d1igtb4

PDB Entry: 1igt, 2.8 Å

PDB Description: structure of immunoglobulin

PDB Compounds: (B:) igg2a intact antibody - mab231

SCOP Domain Sequences for d1igtb4:

Sequence; same for both SEQRES and ATOM records:

>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

Timeline for d1igtb4:

• d1igtb4 first appeared (with stable ids) in SCOP 1.55
  
• d1igtb4 appears in SCOP 1.73
  
• d1igtb4 appears in SCOPe 2.01
  
• d1igtb4 appears in the current release, SCOPe 2.08