![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
![]() | Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry) |
![]() | Domain d1igtb4: 1igt B:363-474 [20869] Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3 |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igtb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2} svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr
Timeline for d1igtb4: