Lineage for d3bpca2 (3bpc A:108-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023645Species Mouse (Mus musculus) [TaxId:10090] [88567] (355 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2023697Domain d3bpca2: 3bpc A:108-213 [208687]
    Other proteins in same PDB: d3bpca1, d3bpcb1, d3bpcb2
    automated match to d3t65a2
    complexed with kda, kdb, mg, zn

Details for d3bpca2

PDB Entry: 3bpc (more details), 1.85 Å

PDB Description: co-crystal structure of S25-2 Fab in complex with 5-deoxy-4-epi-2,3-dehydro Kdo (4.8) Kdo
PDB Compounds: (A:) Fab, antibody fragment (IgG1k), light chain

SCOPe Domain Sequences for d3bpca2:

Sequence, based on SEQRES records: (download)

>d3bpca2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records): (download)

>d3bpca2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskds
tysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3bpca2:

Click to download the PDB-style file with coordinates for d3bpca2.
(The format of our PDB-style files is described here.)

Timeline for d3bpca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bpca1